Instructions to use InstaDeepAI/IDP-ESM2-150M with libraries, inference providers, notebooks, and local apps. Follow these links to get started.
- Libraries
- Transformers
How to use InstaDeepAI/IDP-ESM2-150M with Transformers:
# Use a pipeline as a high-level helper from transformers import pipeline pipe = pipeline("feature-extraction", model="InstaDeepAI/IDP-ESM2-150M")# Load model directly from transformers import AutoTokenizer, AutoModelForMaskedLM tokenizer = AutoTokenizer.from_pretrained("InstaDeepAI/IDP-ESM2-150M") model = AutoModelForMaskedLM.from_pretrained("InstaDeepAI/IDP-ESM2-150M", device_map="auto") - Notebooks
- Google Colab
- Kaggle
| library_name: transformers | |
| pipeline_tag: feature-extraction | |
| model_name: InstaDeepAI/IDP-ESM2-150M | |
| # IDP-ESM2-8M | |
| **IDP-ESM2-150M** is an ESM2-style encoder for intrinsically disorded protein sequence representation learning, trained on [IDP-Euka-90](https://huggingface.co/datasets/InstaDeepAI/IDP-Euka-90). | |
| This repository provides a Transformer encoder suitable for extracting **per-sequence embeddings** (mean-pooled over residues with padding masked out). | |
| --- | |
| ## Quick start: generate embeddings | |
| The snippet below loads the tokenizer and model, runs a forward pass on a couple of sequences and extracts embeddings for each sequence. | |
| ```python | |
| from transformers import AutoTokenizer, AutoModel | |
| import torch | |
| # --- Config --- | |
| model_name = "InstaDeepAI/IDP-ESM2-150M" | |
| # --- Load model and tokenizer --- | |
| tokenizer = AutoTokenizer.from_pretrained("facebook/esm2_t6_8M_UR50D") | |
| model = AutoModel.from_pretrained(model_name) | |
| model.eval() | |
| # (optional) use GPU if available | |
| device = "cuda" if torch.cuda.is_available() else "cpu" | |
| model.to(device) | |
| # --- Input sequences --- | |
| sequences = [ | |
| "MDDNHYPHHHHNHHNHHSTSGGCGESQFTTKLSVNTFARTHPMIQNDLIDLDLISGSAFTMKSKSQQ", | |
| "PADRDLSSPFGSTVPGVGPNAAAASNAAAAAAAAATAGSNKHQTPPTTFR", | |
| ] | |
| # --- Tokenize --- | |
| inputs = tokenizer( | |
| sequences, | |
| return_tensors="pt", | |
| padding=True, | |
| truncation=True, | |
| ) | |
| inputs = {k: v.to(device) for k, v in inputs.items()} | |
| # --- Forward pass --- | |
| with torch.no_grad(): | |
| outputs = model(**inputs) | |
| embeddings = outputs.last_hidden_state # shape: (batch, seq_len, hidden_dim) | |